PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016461218.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 443aa    MW: 48429.3 Da    PI: 8.6853
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016461218.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162064147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a+k++G   W++I +++g ++t+ q++s+ qk+
   XP_016461218.1 20 RERWTEEEHRKFLEAIKLYGRA-WRRIEEHVG-TKTAVQIRSHAQKF 64
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.05E-161468IPR009057Homeodomain-like
PROSITE profilePS5129422.4371569IPR017930Myb domain
TIGRFAMsTIGR015572.2E-171867IPR006447Myb domain, plants
SMARTSM007171.2E-131967IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.2E-102060IPR009057Homeodomain-like
PfamPF002497.1E-142063IPR001005SANT/Myb domain
CDDcd001676.52E-112265No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MASAEMADQA RKAYTISKQR ERWTEEEHRK FLEAIKLYGR AWRRIEEHVG TKTAVQIRSH  60
AQKFFSKVVR ESNSGDASSV KPIEIPPPRP KRKPMHPYPR KLATPVKSGT LVPEKLTRSI  120
SPNMSMSEQE NQSPTSVLSA HGSDALGTGD SSKRSGSASP VSSAGGGNSD GFVLSEPPNF  180
ILQDSSTPAQ ANASTNPENQ ACVKLELLPQ EGSAETSSTP CLKLFGKTVL VTESQRPCPT  240
SGTCKIETDV NDEAALPTAS WNIMPMKFTA SDSDCVSSTL TMGTPPPFYY LPSQNENQWP  300
TRCASATLLP WGSSCASVSF PCIQVLNPIP IKGRPIFNDN NLEDKQNQKE GSSTGSNTEP  360
VSTEMSGDKN MDVEAQSSQH PLEKVRKELS SRPSETSSLV RRASSTKRIK GFVPYKRCLA  420
ERGTNSSRLS GEEREEQRTR LCM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016461218.10.0PREDICTED: protein REVEILLE 1-like isoform X3
TrEMBLM1BXP31e-179M1BXP3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552631e-178(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.12e-49MYB_related family protein